PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G169100.1
Common NamePOPTR_0003s16750g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 158aa    MW: 17992.4 Da    PI: 10.0522
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G169100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.71e-3280138159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  Potri.003G169100.1  80 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHQ 138
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-3365138IPR003657WRKY domain
SuperFamilySSF1182901.57E-2972139IPR003657WRKY domain
PROSITE profilePS5081129.58575140IPR003657WRKY domain
SMARTSM007744.0E-3880139IPR003657WRKY domain
PfamPF031062.7E-2681138IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MSLNMINSYA STDFEGTRGN GLLGLMQEMQ APASLNFDDI SQNRGFVGSG IEGKLGKNKG  60
EKKIRKPKYA FQTRSRVDIL DDGYRWRKYG QKAVKNNKFP RSYYRCTHQG CNVKKQVQRL  120
TKDEGVVVTT YEGMHSHQIE KSPDNFEHIL SQMQIYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-2870139776Probable WRKY transcription factor 4
1wj2_A2e-2870139776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3774380.0GQ377438.1 (Populus tomentosa x P. bolleana) x P. tomentosa WRKY transcription factor 18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304741.21e-116hypothetical protein POPTR_0003s16750g
SwissprotQ9FYA26e-55WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9GVW01e-116B9GVW0_POPTR; Uncharacterized protein
STRINGPOPTR_0003s16750.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.19e-56WRKY DNA-binding protein 75